DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:100868

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:260 Identity:79/260 - (30%)
Similarity:123/260 - (47%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETE-LV 296
            ||.:..|. ::|.|   ..|....:||.|::..:|.:..|||||....:||.||......|. |:
Zfish    28 CGTAPLNS-RIVGG---QNAPVGAWPWQVSLQRDGSHFCGGSLINNQWILTAAHCFPNPSTTGLL 88

  Fly   297 VRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNK 361
            |..|...|.|.....:|.  .|...:.|..::..:..|::.||.|.|....:::||.|||...:.
Zfish    89 VYLGLQKLASFESYSMSS--AVSNIIKHPNYNSDTEDNDITLLQLASTVSFSNYIRPICLAASDS 151

  Fly   362 S-FAGRRCTVAGWGKMRYEDQRYST-VLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG- 423
            : |.|....:.|||.........|. .|::||:.:|....|      ..|....::..|::||| 
Zfish   152 TFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKC------NCLYGVSKITDNMVCAGL 210

  Fly   424 --GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486
              |  |:|:|.||.|..:....|    .|:.|:|||::|.||.|...|.:||.|||:.:||.:::
Zfish   211 LQG--GKDSCQGDSGGPMVSKQG----SVWIQSGIVSFGTGCAQPNFPGVYTRVSKYQSWIQQRI 269

  Fly   487  486
            Zfish   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/240 (31%)
Tryp_SPc 252..482 CDD:214473 72/235 (31%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 74/245 (30%)
Tryp_SPc 37..267 CDD:238113 76/246 (31%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.