DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:112038

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:272 Identity:86/272 - (31%)
Similarity:130/272 - (47%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CG---MSNANGLQMVEGITIDQARPAQYPWAVAIFHNG--QYLAGGSLIQPNVVLTVAHRVITIE 292
            ||   ::|.||     |   |.|....:||..:|....  .::.|||||..:.||:.||..:...
Zfish    27 CGQAPLNNNNG-----G---DDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITA 83

  Fly   293 TELVVRAGDWDLKSDREIFLSEQ-----------REVERAVIHEGFDFKSGANNLALLFLNSPFK 346
            |            ::.:|||..|           |.:.:.|||..:...:..|::|||.|:|...
Zfish    84 T------------ANIKIFLGRQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVT 136

  Fly   347 LNDHIRTICLPTPNKSFA-GRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLG 410
            ..|:||.:||.:.:..|| |.:..:.||.|.|..|.:.:.||::|||.||:...|....:..   
Zfish   137 FTDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGI--- 198

  Fly   411 AKFELPKNIICAG-GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTE 474
                :..|:|||| .|.|:|.|.||.|..:.    .:|...:.|:|||::|..||....|.|||.
Zfish   199 ----ITDNMICAGINEGGKDACQGDSGGPMV----SQNGSRWIQSGIVSFGRECGLPRYPGIYTR 255

  Fly   475 VSKFTNWITEKL 486
            ||::.:|||.:|
Zfish   256 VSQYQSWITSEL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 79/249 (32%)
Tryp_SPc 252..482 CDD:214473 75/244 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 78/256 (30%)
Tryp_SPc 37..263 CDD:238113 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.