DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and aqrs

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:234 Identity:52/234 - (22%)
Similarity:94/234 - (40%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLK 305
            :::.:.:..|..|...|  .|.:.:.|..:..|:||...:|:|..|.......:|:.......|.
  Fly    61 VEVQKRLPFDATRDLTY--YVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLS 123

  Fly   306 SDREIFLSEQREVERAVIHEGFDFKSGANN-----LALLFLNSPFKLN-DHIRTICLPTPNKSFA 364
            ....:.|.:..|..:.:   ||......|.     :|||.|::  ||: |..|.|.|.. .|..|
  Fly   124 ILTGVELDDNPEPHQVI---GFFMPVNKNERFTNYVALLALSN--KLDRDKYRYIPLHR-KKPQA 182

  Fly   365 GRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGE--LG 427
            |....:|.:|..:::.:.|:|.:..:....::..:.|.|..||     ||  .:.||...:  ..
  Fly   183 GDDVKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVST-----FE--PDFICVRNKRHSK 240

  Fly   428 RDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQE 466
            :.||:...|..|..    :|    :.|.|..:|..|.::
  Fly   241 KTTCSTRPGDPLLI----DN----KLAAINIYGEHCDED 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 52/225 (23%)
Tryp_SPc 252..482 CDD:214473 51/223 (23%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 48/211 (23%)
Tryp_SPc 83..268 CDD:304450 47/205 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.