DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG31266

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:114/284 - (40%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GSSELL----SPSCGMSNANGLQMVEGITIDQ------ARPAQYPWAVAIFHNGQY-LAGGSLIQ 277
            |.:|.:    .|..|::|....:..|.:...:      |....:||..:|.:...| |.|..::.
  Fly    20 GPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILD 84

  Fly   278 PNVVLTVAHRVITIE-TELVVRAGD---WDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLAL 338
            ...|||.|..|..:. ..|:|..|.   |||       .:....|.:..:|..||.....|::||
  Fly    85 ETWVLTAASCVAGLRPLNLLVVTGTVDWWDL-------YAPYYTVSQIHVHCNFDKPLYHNDIAL 142

  Fly   339 LFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKM-------RYEDQRYSTVLKKVQLLVVN 396
            |.|:|..:.||..:.|.|...::...|.:.|.||||..       ||..:...|.|..       
  Fly   143 LQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPV------- 200

  Fly   397 RNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQ---AGIVN 458
             :.|.:.|::     :.::....:|...:.|:..|.||.|..|          :.||   .||.|
  Fly   201 -DACREKLQN-----QDDVDLGHVCVQMDAGQGACHGDTGGPL----------IDEQQRLVGIGN 249

  Fly   459 WGVGCGQEGIPAIYTEVSKFTNWI 482
            |||.||: |.|.:|...:.:.:||
  Fly   250 WGVPCGR-GYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 66/254 (26%)
Tryp_SPc 252..482 CDD:214473 64/244 (26%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 64/251 (25%)
Tryp_SPc 52..275 CDD:238113 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.