DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG14892

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:399 Identity:84/399 - (21%)
Similarity:125/399 - (31%) Gaps:158/399 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SSELLSPSCGMSNA-NGLQMVEGITIDQARPAQYPW--AVAIFHNG----QYLAGGSLIQPNVVL 282
            ||......||...| .|.:::.|...::   .|:||  ::.:.|..    .:..|..||....:|
  Fly    62 SSRQFETDCGCRPARRGPRIIAGAATNE---GQFPWQASLELLHPSLGFLGHWCGAVLIHQYWIL 123

  Fly   283 TVAHRV--------ITIETELVVRAGDWDLKSDREIFLSEQR-EVERAVIHEGF-DFKSGANNLA 337
            :.||.|        |.....:|:...|.|::|.     :||| .||:.|:|..: :||   :::.
  Fly   124 SAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESG-----NEQRIPVEKIVMHHRYHNFK---HDVV 180

  Fly   338 LLFLNSPFKLN--DHIRTICLP----------------------------------TPNK----- 361
            |:.|:.|..|.  .:||.||||                                  .|.|     
  Fly   181 LMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFL 245

  Fly   362 -SFAGRR---------------------------------------------------------- 367
             |...||                                                          
  Fly   246 RSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAE 310

  Fly   368 -----------------CTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFEL 415
                             |...||||...... .|..|.|.|:.:.....|.     ...|:...:
  Fly   311 QKHPKVSDEPKEIAFVDCVATGWGKANISGD-LSNQLLKTQVPLHQNGRCR-----DAYGSFVNI 369

  Fly   416 PKNIICAG---GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSK 477
            ....:|||   ||.|  ||.||.|..|.|.:  ...|.:...|:.::|.||..||.|.:||..|.
  Fly   370 HGGHLCAGKLNGEGG--TCVGDSGGPLQCRL--SRDGPWILVGVTSFGSGCALEGFPDVYTRTSY 430

  Fly   478 FTNWITEKL 486
            :..||.:.:
  Fly   431 YMKWIEDTI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 77/370 (21%)
Tryp_SPc 252..482 CDD:214473 75/365 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 76/375 (20%)
Tryp_SPc 81..438 CDD:238113 78/377 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.