DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG3916

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:115/274 - (41%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 NVGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAH 286
            :|.:|...||    :..||     |..:::..|.|....:......|:..|||::....|||.||
  Fly    19 DVVTSTTESP----TRING-----GQRVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAH 74

  Fly   287 RVITIETE---LVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSG-ANNLALLFLNSPFKL 347
            .:..::.|   :||...:|.....|...:::.       :|..:..... .|::||:.:..||:|
  Fly    75 CMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKH-------VHPQYSMNPRIINDIALVKVTPPFRL 132

  Fly   348 -NDHIRTICLPTPNKSFAGRRCTV--AGWGKMRYEDQRYSTVLKKVQLL----VVNRNVCEKFLR 405
             ...|.||.:...::  .|.:..|  .|||... .....:|:..::|.|    :.|.:..:|..|
  Fly   133 ERSDISTILIGGSDR--IGEKVPVRLTGWGSTS-PSTSSATLPDQLQALNYRTISNEDCNQKGFR 194

  Fly   406 STRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPA 470
            .||         |.|||....|:..|.||.|..|...  |:...:   .|||::|.....:|.|.
  Fly   195 VTR---------NEICALAVQGQGACVGDSGGPLIRP--GKQPHL---VGIVSYGSSTCAQGRPD 245

  Fly   471 IYTEVSKFTNWITE 484
            :||.||.|..:|::
  Fly   246 VYTRVSSFLPYISQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 62/246 (25%)
Tryp_SPc 252..482 CDD:214473 61/240 (25%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 64/255 (25%)
Tryp_SPc 31..260 CDD:238113 65/258 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.