DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG17404

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:248 Identity:74/248 - (29%)
Similarity:113/248 - (45%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PAQY-PWAVAIFH---NGQ-YLAGGSLIQPNVVLTVAHRVITIE-TELVVRAGDWDL--KSDREI 310
            |.:: |:.|::.:   .|| :..|||:|.||.:||.||....:. :.:.|.||...|  |..|..
  Fly    43 PGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRGLNEKGSRSQ 107

  Fly   311 FLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDH-IRTICLPTPNKSFAGR--RCTVAG 372
            .||..       ||..:. :...::||:|.:..|.|||:. |..|...:..|.|.|.  ..|:.|
  Fly   108 VLSYS-------IHPKYQ-ELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDFVGGGVPVTLTG 164

  Fly   373 WGKMR-------YEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDT 430
            || :|       .::..|..||:::....::.:.|       |......:....|||.|.. |..
  Fly   165 WG-LRLPVPFPFLDNVNYPNVLQRMSYHTISNSEC-------RNAGMESVTDTEICARGPF-RGA 220

  Fly   431 CTGDGGSALFCSIGGENSGVYEQAGIVNWG-VGCGQEGIPAIYTEVSKFTNWI 482
            |:||.|..|..    |:....:|.|||::| |.||....|.:||.||.|::||
  Fly   221 CSGDSGGPLVM----ESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/248 (30%)
Tryp_SPc 252..482 CDD:214473 72/246 (29%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 72/246 (29%)
Tryp_SPc 35..269 CDD:238113 72/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.