DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG6865

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:129/267 - (48%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVV 297
            |.:.|.   ::|.|   .:|...:.|:.|::...|.:..||::|....:||..|.:.....:.:.
  Fly    28 CSVRNP---KIVGG---SEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMK 86

  Fly   298 RA---GDWDLKSDREIFLSE--------QREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHI 351
            .|   |...|.|.|| :|:.        :.:.:..|.|..:|.....:::|||.|..|.:.:.||
  Fly    87 PAQIQGVVGLHSIRE-YLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHI 150

  Fly   352 RTICLPTP--NKSFAGRRCTVAGWG---KMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGA 411
            :..|:.:.  ::|......||:|||   :.:.|:.| |.||:|..:.:.|...||:..||  ||.
  Fly   151 QPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDR-SDVLRKATVKIWNNEACERSYRS--LGK 212

  Fly   412 KFELPKNIICAGGELGR-DTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEV 475
            ...:.:..:|||.|.|: |:|..|.|..|.       |..:...|:|:.|:||.:.|:|.|||.|
  Fly   213 SNTIGETQLCAGYENGQIDSCWADSGGPLM-------SKEHHLVGVVSTGIGCARPGLPGIYTRV 270

  Fly   476 SKFTNWI 482
            ||:.:|:
  Fly   271 SKYVSWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 72/250 (29%)
Tryp_SPc 252..482 CDD:214473 71/246 (29%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 73/255 (29%)
Tryp_SPc 35..280 CDD:238113 74/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.