DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG6462

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:300 Identity:68/300 - (22%)
Similarity:117/300 - (39%) Gaps:83/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GNPT----TNVGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAV--AIFHNGQYL--AGG 273
            ||.|    |.:...||                       |....:|:.|  .|..:|..|  .||
  Fly    67 GNQTAAVRTRIAGGEL-----------------------ATRGMFPYQVGLVIQLSGADLVKCGG 108

  Fly   274 SLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDREIFLSEQREVER-AVIHEGF----DFK--S 331
            |||....|||.||.:    |:.:..    .:.:...:|...:..||. .|.|..|    |:.  .
  Fly   109 SLITLQFVLTAAHCL----TDAIAA----KIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFG 165

  Fly   332 GANNLALLFLNSPFKLNDHIRTICLPTP--NKSF-AGRRCTVAGWGKMRYEDQRYSTVLKKVQLL 393
            |.::|||:.|....:.::.::.|.|...  :::| .|:..|::|||.:.....:.:.:|:.:...
  Fly   166 GYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAE 230

  Fly   394 VVNRNVCEKFLRSTRLGAKFELP-----KNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYE- 452
            |:::..|..:.          ||     :..:|..|..||..|.||.|..:          ||. 
  Fly   231 VIDQERCICYF----------LPGLVSQRRHLCTDGSNGRGACNGDSGGPV----------VYHW 275

  Fly   453 -----QAGIVNWG--VGCGQEGIPAIYTEVSKFTNWITEK 485
                 ..|:.::|  .|| :.|.|.:||.::.:..||.::
  Fly   276 RNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 62/261 (24%)
Tryp_SPc 252..482 CDD:214473 60/256 (23%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 62/286 (22%)
Tryp_SPc 77..314 CDD:238113 64/288 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.