DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG13527

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:115/264 - (43%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 ITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDL---KSDR 308
            ::|....|.:|      |.:..| .||.|:....|:|.||.|:. :::::.:| .|.|   .|..
  Fly    45 VSIRSRTPNKY------FGDNHY-CGGGLLSNQWVITAAHCVMG-QSKIMYKA-RWLLVVAGSPH 100

  Fly   309 EIFLSEQREV----------ERAVIHEGFDFKSGANNLALLFLNSPFKLND-HIRTICLPTPNKS 362
            .:..:..:.|          :...:|..|       |:||:.|......|| .|..:.||.....
  Fly   101 RLRYTPGKSVCSPVSSLYVPKNFTMHNTF-------NMALMKLQEKMPSNDPRIGFLHLPKEAPK 158

  Fly   363 FAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGE-- 425
            . |.|.||.|||:| |.....:..:.:|.:::::..||:.:.|....|        ::|||..  
  Fly   159 I-GIRHTVLGWGRM-YFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDG--------MMCAGNNNW 213

  Fly   426 -LGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKLLPF 489
             :..:.|:||.||.|   :.|:     ...|||.:.:|||...||::||:|.....||  :...:
  Fly   214 TIDAEPCSGDIGSPL---LSGK-----VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWI--RHTAY 268

  Fly   490 DYRS 493
            |:.|
  Fly   269 DWAS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 65/251 (26%)
Tryp_SPc 252..482 CDD:214473 63/246 (26%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 66/256 (26%)
Tryp_SPc 43..263 CDD:214473 64/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.