DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and tpr

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:296 Identity:84/296 - (28%)
Similarity:146/296 - (49%) Gaps:27/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TTNVGNPTNNGGNPTTNFG-NPTNNGGNPTTNVGSSELLSPSCGMSNANGLQMVEGITIDQARPA 255
            ||:...|..:....||... .|.....||..|....     .||::|.. .::|.|   .:....
  Fly    81 TTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDC-----VCGIANIQ-KRIVGG---QETEVH 136

  Fly   256 QYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELV-VRAGDWDLKSDREIFLSEQ--RE 317
            ||||...:.:.|::....||:....:||.:|.|.....|.: ||.    |:.||::...::  |:
  Fly   137 QYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRL----LEHDRKMSHMQKIDRK 197

  Fly   318 VERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQR 382
            |...:.|..::.::..|::|::.|:.|.:.|:.:..:|:|||.:||.|....|.|||.::.....
  Fly   198 VAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPT 262

  Fly   383 YSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG-GELGRDTCTGDGGSALFCSIGGE 446
             |..|::||:.:::::.|    |.:|.|.|  :..|::|.| .|.|:|:|.||.|..|.....|.
  Fly   263 -SDTLQEVQVPILSQDEC----RKSRYGNK--ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGT 320

  Fly   447 NSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
            ..  ::.||:|:||.||.:.|.|.:|..|:::..||
  Fly   321 RE--HQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 70/237 (30%)
Tryp_SPc 252..482 CDD:214473 68/233 (29%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 70/243 (29%)
Tryp_SPc 127..356 CDD:238113 72/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.