DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG4927

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:261 Identity:71/261 - (27%)
Similarity:115/261 - (44%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QARPAQYPWAVAIFHNGQ------YLAGGSLIQPNVVLTVAHRVITIET------------ELVV 297
            :|...::|:...:...|:      :..|..:|.|..|||.||.:.|.||            :.||
  Fly   110 KAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVV 174

  Fly   298 RAGDWDLKSDREIFLSEQREVERAVIHEGF----DFKSGANNLALLFLNSPFKLNDHIRTICLPT 358
            |.|:.|..|..:....:...|...|:|..:    |..|..|::|::.|......::::...|||.
  Fly   175 RLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPL 239

  Fly   359 P--NKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIIC 421
            .  |:..   :...||||... |....|:.|.||.|...:...|     |.||..|.:: :..:|
  Fly   240 DGGNEQL---QVAAAGWGATS-ESGHASSHLLKVSLDRYDVAEC-----SQRLEHKIDV-RTQLC 294

  Fly   422 AGG-ELGRDTCTGDGGSALFCSIGGENSGVY----EQAGIVNWGVGCGQEGIPAIYTEVSKFTNW 481
            ||. ....|||.||.|..:|.     ...:|    :..||.::|:.||.:|:|::||:|..:|:|
  Fly   295 AGSRSTSADTCYGDSGGPVFV-----QHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDW 354

  Fly   482 I 482
            |
  Fly   355 I 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 71/261 (27%)
Tryp_SPc 252..482 CDD:214473 69/258 (27%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 71/261 (27%)
Tryp_SPc 105..355 CDD:214473 69/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.