DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG8738

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:304 Identity:113/304 - (37%)
Similarity:164/304 - (53%) Gaps:25/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 NPTTNF-----------GNPTNNGGNP-TTNVGSSELLSPSCGMSNANGL-QMVEGITIDQARPA 255
            |..:||           |:....|.|| ..||  .:.|...||.||..|| ..::|....::..|
  Fly   149 NEESNFGCRVVEECCPLGDQIEEGRNPIQRNV--KDFLLKGCGYSNPKGLYYQLDGYNNGESVFA 211

  Fly   256 QYPWAVAIFH-NGQYLAGGSLIQPNVVLTVAHRVIT-IETELVVRAGDWDLKSDREIFLSEQREV 318
            ::||.||:.. .|.::.||:||.|.:|||.||.|.. .|..|:||||||||.|..|:...:.|.:
  Fly   212 EFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAI 276

  Fly   319 ERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTP-----NKSFAGRRCTVAGWGKMRY 378
            .....||.|:..:..|::||:.|..||::..||:.||||.|     ........|...||| :||
  Fly   277 SELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWG-LRY 340

  Fly   379 EDQR-YSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCS 442
            ...| ...:||:::|..|:...|::.||.|.||.::.|..:..||||..|:|||.|||||.|||:
  Fly   341 STSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCT 405

  Fly   443 IGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486
            :.|:... |:..|:|:||:.|.::.:||.||.|:...|||.|::
  Fly   406 LPGQKDR-YQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 95/242 (39%)
Tryp_SPc 252..482 CDD:214473 93/237 (39%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 95/241 (39%)
Tryp_SPc 207..444 CDD:214473 93/238 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457430
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.