DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG8586

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:475 Identity:142/475 - (29%)
Similarity:200/475 - (42%) Gaps:123/475 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RSSN-CGNTKICC--------------------AVLRKPGGTVLIEPNGPEDDKVGVNGINAQLS 84
            |||. ||..::||                    :.:|....:|| ||  |.::..|.   |.:..
  Fly    54 RSSRICGTQRVCCEKAQLDSYDRWLVERTTTVPSTIRNKVSSVL-EP--PPNESCGQ---NMECV 112

  Fly    85 PTRELTRDRPNTIESQVKEINDFSGRPTNNERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYP 149
            | |:|.||         ..||| ||....|.|....:.:...|........|::...|       
  Fly   113 P-RKLCRD---------NIIND-SGISLINPRISPIQCSKSLYRCCAVDQKVDDSESP------- 159

  Fly   150 SNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGYPANNGGYPTTNVGNPTNNGGNPTTNFGNPTN 214
                        |.|....:...|.|| :|..|...:|..:|.:                     
  Fly   160 ------------YLVKQANFKYKNCGY-SNPKGLIPDNDKFPYS--------------------- 190

  Fly   215 NGGNPTTNVGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQ-YLAGGSLIQP 278
                                          |.::|.    .::||.|.||...| :|.||:||.|
  Fly   191 ------------------------------EDVSIF----GEFPWMVGIFTGRQEFLCGGTLIHP 221

  Fly   279 NVVLTVAHRVI--TIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFL 341
            .:|:|.:|.::  |::| ||.|||||||.|..|.:..:...::..::|..||..|..|::|||.|
  Fly   222 RLVVTTSHNLVNETVDT-LVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLL 285

  Fly   342 NSPFKLNDHIRTICLPTP-----NKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCE 401
            :.|.:|..||:.:|||.|     ........|...|||.......:...|||::.|.:|.|..|:
  Fly   286 DEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQ 350

  Fly   402 KFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQE 466
            ..||:|||.|:|.|..:.|||||:.|:|||.|||||.|||.:.||... |:..|||:|||.|..|
  Fly   351 AKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDR-YQLVGIVSWGVECAVE 414

  Fly   467 GIPAIYTEVSKFTNWITEKL 486
            .|||:|..|.....||.||:
  Fly   415 DIPAVYVNVPHLRGWIDEKI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089 10/52 (19%)
Tryp_SPc 250..485 CDD:238113 99/242 (41%)
Tryp_SPc 252..482 CDD:214473 97/237 (41%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 99/237 (42%)
Tryp_SPc 197..430 CDD:214473 97/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.