DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG30371

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:376 Identity:89/376 - (23%)
Similarity:141/376 - (37%) Gaps:92/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 YPANNGGYPANNGG----YPTT-----------NVGNPTNNGGNPTTNFGNPT----------NN 215
            ||.|   ||   ||    |..|           ::|.|..||...|.||...|          |.
  Fly    42 YPNN---YP---GGTSCRYKFTAPLDYYIQVQCSLGIPKGNGQCTTDNFWLDTEGDLLMRGAENF 100

  Fly   216 GGNPTTNVGS--SELL----------------------SPSCGMSN----ANGLQMVEGITIDQA 252
            .|:.|.:..|  :||:                      :.:||.|.    |||         .||
  Fly   101 CGSGTLSRESLFTELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANG---------QQA 156

  Fly   253 RPAQYPWAVA---IFHNGQYLAGGSLIQPNVVLTVAHRVITIE--TELVVRAGDWDLKSDREIFL 312
            ...::|...|   :..|.....||:::....:||.||.:..:.  |.:|...|..||.:......
  Fly   157 AANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRY 221

  Fly   313 SEQREVERAVIHEGFDFKSGANN-LALLFLNSPFKLNDHIRTICLPTPNKS--FAGRRCTVAGWG 374
            .:|..:::.:.||.:......|| :|:|...|..:.:..:..||||....|  |......|.|:|
  Fly   222 YQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYG 286

  Fly   375 KMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICA---GGELGRDTCTGDGG 436
            .:.:.... ||.|:|:.|.||....|:     |.......:....:|.   .| .|||:|..|.|
  Fly   287 TVFFAGPT-STSLQKINLNVVTNQDCQ-----TEYNNVATIYTGQMCTYDYSG-TGRDSCQFDSG 344

  Fly   437 SALFCSIGGENSGVYEQAGIVNWGVGCGQEGIP-AIYTEVSKFTNWITEKL 486
            ..:..    ..|..: ..||:::|..|.:...| .:.|.::.:.:||.:|:
  Fly   345 GPVIL----RKSRQF-LVGIISYGKSCAESQYPMGVNTRITSYISWIRQKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089 5/12 (42%)
Tryp_SPc 250..485 CDD:238113 59/246 (24%)
Tryp_SPc 252..482 CDD:214473 56/241 (23%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042 9/30 (30%)
Tryp_SPc 149..386 CDD:214473 60/257 (23%)
Tryp_SPc 150..389 CDD:238113 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.