DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Corin

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:254 Identity:76/254 - (29%)
Similarity:126/254 - (49%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QARPAQYPWAVAIFHNGQ--YLAGGSLIQPNVVLTVAH-----RVITIETELVVRAGDWDLK--- 305
            ||.|..:|:..||....:  :...|.||....|||.:|     .||.:|        ||.::   
  Fly  1109 QASPGNWPFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLE--------DWTIQLGV 1165

  Fly   306 SDREIF-LSEQREVERAVI-HEGFDFK-SGANNLALLFLNSPFKLNDHIRTICLPTPN--KSFAG 365
            :.|..| .|.|:...:||| |..::.. :..|::||..|.:....::|:..:|||.|:  ....|
  Fly  1166 TRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVRNLHPG 1230

  Fly   366 RRCTVAGWGKMRYEDQR--YSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG-GELG 427
            ..|||.||||...:|.:  |..::.:||:.::.||.|:::|.:      ..:.:.::||| .:.|
  Fly  1231 TLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQCDEWLDN------LTVSEGMVCAGFDDGG 1289

  Fly   428 RDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486
            :|.|.||.|..|.|...||.:..: ..|||:||:.|....:|.:|..|.::..||.|::
  Fly  1290 KDACQGDSGGPLLCPYPGEKNRWF-VGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQI 1347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 75/251 (30%)
Tryp_SPc 252..482 CDD:214473 72/247 (29%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 73/248 (29%)
Tryp_SPc 1104..1346 CDD:238113 75/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.