DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss33

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:128/273 - (46%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAH----RVITIE 292
            :||....:. ::|.|   ..|:..::||..:|.|.|.::.|||||.|..|||..|    ||...|
Mouse    88 ACGQPRMSS-RIVGG---RDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHCFPRRVWPSE 148

  Fly   293 TELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLP 357
            ..:::.|...|::|..|:.:    .|.|.::...:.......:||||.|..|..|:..|:.:|||
Mouse   149 YSVLLGALSLDVRSSHELLV----PVLRVLLPPDYSEDEARGDLALLQLRHPVSLSTRIQPVCLP 209

  Fly   358 TP-NKSFAGRRCTVAGWG---------KMRYEDQRYSTVLKKVQLLVVNRNVCEKFLR---STRL 409
            .| :....|..|.|.|||         |.|        .|:.|::.:::...|::...   :...
Mouse   210 APGSHPPPGSPCWVTGWGSLSPGVPLPKGR--------PLQGVRVPLLDSRACDRLYHVGANVPQ 266

  Fly   410 GAKFELPKNIICAGGELG-RDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYT 473
            |.:..||.| :|||...| :|.|.||.|..|.|.    .||.:...|:|:||.||.....|.:||
Mouse   267 GERIVLPGN-LCAGYRRGHKDACQGDSGGPLTCM----ESGHWVLVGVVSWGKGCALPNRPGVYT 326

  Fly   474 EVSKFTNWITEKL 486
            .|:|::.||..:|
Mouse   327 NVAKYSPWIQARL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 78/252 (31%)
Tryp_SPc 252..482 CDD:214473 76/247 (31%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 79/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.