DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG18478

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:255 Identity:122/255 - (47%)
Similarity:171/255 - (67%) Gaps:2/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETE-LV 296
            ||..|.:.:::...:|..||:||::||.:|:.||...:.|||||.|::|||.|||:...:.| :|
  Fly    31 CGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIV 95

  Fly   297 VRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNK 361
            |.||:|:..|..|.:..|:..|.:.|||:.|:::.||||||||||:..|.|...|.||||||..:
  Fly    96 VSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKR 160

  Fly   362 SFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGEL 426
            |.:..||.||||||.::.|..|..||||:.|.:|.|::|:..||.||||..:.||:.:||||||.
  Fly   161 SLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEK 225

  Fly   427 GRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486
            ..|.||||||.||||.: .|:...:||.|||||||||.::.:||.||:|.:|..||.:::
  Fly   226 DNDACTGDGGGALFCPM-TEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 118/235 (50%)
Tryp_SPc 252..482 CDD:214473 115/230 (50%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 117/233 (50%)
Tryp_SPc 50..280 CDD:214473 115/230 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.