DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG9377

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:275 Identity:83/275 - (30%)
Similarity:135/275 - (49%) Gaps:12/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PTTNVGSSELLSPSCGMSNANGLQMVE-GITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVL 282
            ||..: ..|::|..||..:.....:.. |....:|:..::||.||::.:..||..|:||.|..|:
  Fly    74 PTPKI-PEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVI 137

  Fly   283 TVAHRVITIETELV-VRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLN--SP 344
            |.||.|...|.|.| :.||:||...:.|....:||.|...::|..:.....|:|:|:|.::  .|
  Fly   138 TTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKP 202

  Fly   345 FKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRL 409
            |:|..:::.||||.|...:...:|.|:||  .|.:..|.:.:.|:..|.|:..:.|...||.:.|
  Fly   203 FQLAPNVQPICLPPPRIMYNYSQCYVSGW--QRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLL 265

  Fly   410 GAKFELPKNIICAGGELGRDTCTGD---GGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAI 471
            |.:.....:::||||:.|...| ||   ....|.|.:.|.:.. :..||::.....|....:..|
  Fly   266 GRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSGHDDR-FHLAGLLTRTARCDGPQLLGI 328

  Fly   472 YTEVSKFTNWITEKL 486
            ||.|..:..||..||
  Fly   329 YTNVKLYRQWIDLKL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/240 (31%)
Tryp_SPc 252..482 CDD:214473 72/235 (31%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 73/238 (31%)
Tryp_SPc 105..339 CDD:214473 72/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.