DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG3355

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:255 Identity:89/255 - (34%)
Similarity:131/255 - (51%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIF---HNGQYLAGGSLIQPNVVLTVAHRVITIETE 294
            ||..|.|  ::|.|   .|.|..:|||...:.   |..:...|||||....|||.||.|.....:
  Fly    68 CGTPNVN--RIVGG---QQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQ 127

  Fly   295 LVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTP 359
            :.:|....| :|.|:..:  .|:|.:..:|..:|.....|::|||.|.||..|..::|.:|||..
  Fly   128 ITIRLLQID-RSSRDPGI--VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEA 189

  Fly   360 NKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG- 423
            |.:|.|:...|||||.:: |....|..|::|.:.|:....|    |.||.  |.::.:.::||| 
  Fly   190 NHNFDGKTAVVAGWGLIK-EGGVTSNYLQEVNVPVITNAQC----RQTRY--KDKIAEVMLCAGL 247

  Fly   424 -GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
             .:.|:|.|.||.|..|..     |.|.|:.||:|::|.||.|:..|.:|..||||.:||
  Fly   248 VQQGGKDACQGDSGGPLIV-----NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 83/238 (35%)
Tryp_SPc 252..482 CDD:214473 80/234 (34%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/244 (34%)
Tryp_SPc 76..305 CDD:238113 85/245 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.