DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and prss60.3

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:265 Identity:85/265 - (32%)
Similarity:136/265 - (51%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHN---GQYLAGGSLIQPNVVLTVAHRVITI-ET 293
            ||.:..| .::|.|:   .|.|..:||.|:: |:   |.:..|||||....|||.||.:..: ||
Zfish    27 CGQAPLN-TRIVGGV---NASPGSWPWQVSL-HSPKYGGHFCGGSLISSEWVLTAAHCLSGVSET 86

  Fly   294 ELVVRAGDWDLKSDREIFLSE-QREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLP 357
            .|||..|   .::.:.|.:.| .|.|.::.:|..::..:..|::|||.|:|.....::||.:||.
Zfish    87 TLVVYLG---RRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLA 148

  Fly   358 TPNKSF-AGRRCTVAGWGKMRY-EDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNII 420
            ..|..: ||....:.|||.::. .:.....:|::..:.||..:.|...|.|.      .:..|:|
Zfish   149 AQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSG------TVTNNMI 207

  Fly   421 CAG-GELGRDTCTGDGGSAL---FCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNW 481
            ||| .:.|:|||.||.|..:   .|:       |:.||||.:||.||.....|.:||.||::.:|
Zfish   208 CAGLTQGGKDTCQGDSGGPMVTRLCT-------VWVQAGITSWGYGCADPNSPGVYTRVSQYQSW 265

  Fly   482 ITEKL 486
            |:.|:
Zfish   266 ISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 79/245 (32%)
Tryp_SPc 252..482 CDD:214473 77/240 (32%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 81/252 (32%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.