DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG4259

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:237 Identity:85/237 - (35%)
Similarity:119/237 - (50%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 AQYPWAVAIFHNG----QYLAGGSLIQPNVVLTVAHRVI-TIETELVVRAGDWDLKSDREIFLSE 314
            |.:||.|::....    :|:..||||.||||||.||.:. |.:.:||||||:||..:     .::
  Fly    37 ATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTST-----TAD 96

  Fly   315 QREVERAVI----HEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGK 375
            |:.|:..|:    ||.|:..:..||:|||.|.|.|::..:|..|.|...........|...||||
  Fly    97 QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGK 161

  Fly   376 MRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALF 440
            :......|.||||.||:.:::..:|     |:|     :||...||..|..|.| |:||||:.|.
  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMC-----SSR-----KLPIQQICGKGLEGID-CSGDGGAPLV 215

  Fly   441 CSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
            |.| ......|.|.|||||......|....::|.|:....||
  Fly   216 CRI-LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 85/237 (36%)
Tryp_SPc 252..482 CDD:214473 83/235 (35%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 84/235 (36%)
Tryp_SPc 39..256 CDD:214473 82/233 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.