DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG1304

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:260 Identity:76/260 - (29%)
Similarity:117/260 - (45%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 NGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRV---------ITIETE 294
            || ::|.|   :.|...|:|..|::.:.|.:..|||::..|.|||.||.|         :.|..|
  Fly    29 NG-RVVGG---EDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAE 89

  Fly   295 -LVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPT 358
             ..:|||..|..|...:.     :|...::||  ::.:..|::|||.|.||..|:..|:.|.|||
  Fly    90 RFTIRAGSNDRFSGGVLV-----QVAEVIVHE--EYGNFLNDVALLRLESPLILSASIQPIDLPT 147

  Fly   359 PNKSFAGRRCTVAGWGKMRYEDQ-----RYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKN 418
            .:.. |.....::|||:::::..     :|:| ||.:.|     ..|::.:   ..|.:.||   
  Fly   148 ADTP-ADVDVIISGWGRIKHQGDLPRYLQYNT-LKSISL-----ERCDELI---GWGVQSEL--- 199

  Fly   419 IICAGGELGRDTCTGD-GGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
              |...|.....|.|| ||.|::      |:.|...||.| |. .|| ...|..|..|.....||
  Fly   200 --CLIHEADNGACNGDSGGPAVY------NNQVVGVAGFV-WS-ACG-TSYPDGYARVYYHNEWI 253

  Fly   483  482
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 72/249 (29%)
Tryp_SPc 252..482 CDD:214473 70/245 (29%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/255 (28%)
Tryp_SPc 32..256 CDD:238113 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.