DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG9673

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:109/247 - (44%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 QYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITI------ETELVVRAGDWDLKSDREIFLSE 314
            :|||:.::.:|..::..|::|..|.:||.||.|.::      .:.|.||.|..:..:...|.   
  Fly    39 EYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIV--- 100

  Fly   315 QREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLP-------------TPNKSFAGR 366
              .|:..:||..:.  :..:::|:|.|:.....:|.|:.|.||             .||    |.
  Fly   101 --NVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPN----GT 157

  Fly   367 RCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTC 431
            ...|||||::  .|...|...:|.....::|::||     ...|..:|   :::|.....|...|
  Fly   158 PVYVAGWGEL--SDGTASYKQQKANYNTLSRSLCE-----WEAGYGYE---SVVCLSRAEGEGIC 212

  Fly   432 TGDGGSALFCSIGGENSGVYEQAGIVNWGVG-CGQEGIPAIYTEVSKFTNWI 482
            .||.|:|:.     ::..|..  |:.::..| ||.: .|.:.|.||.:..||
  Fly   213 RGDAGAAVI-----DDDKVLR--GLTSFNFGPCGSK-YPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 62/247 (25%)
Tryp_SPc 252..482 CDD:214473 60/245 (24%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 60/245 (24%)
Tryp_SPc 29..259 CDD:238113 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.