DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG32376

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:302 Identity:78/302 - (25%)
Similarity:138/302 - (45%) Gaps:38/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GYPANNGGYPTTNVGNPTNNGGNPTTNFGNPTNNGGNPTTNVGSSELLSPSCGMSNANGLQMVEG 246
            ||..:||.:... .|.|.:..  ||.||||.::   ||..|...::...|:         ::|.|
  Fly    20 GYYKDNGTHYLL-YGKPEDIA--PTPNFGNISS---NPFINALEAQESFPT---------RIVNG 69

  Fly   247 ITIDQARP-AQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDREI 310
            ..|    | .:.|:..::.:.|.::.|..:|....:||..|.......:..||.|     ||::.
  Fly    70 KRI----PCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVRVG-----SDQQR 125

  Fly   311 FLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGK 375
            ...:.|.|::.|....::..:..::||::.|.||......:|.:.||:...:...::..|:|||.
  Fly   126 RGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGI 190

  Fly   376 MRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALF 440
            .....|.....|::||:..:.|:.|:|..:.    |..::.|::||| ....:|:|:||.|..| 
  Fly   191 TSANAQNVQRYLRRVQIDYIKRSKCQKMYKK----AGLKIYKDMICA-SRTNKDSCSGDSGGPL- 249

  Fly   441 CSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
                 .:.||.  .|||:||:||..:..|.:|....::..||
  Fly   250 -----TSRGVL--YGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089 3/6 (50%)
Tryp_SPc 250..485 CDD:238113 59/234 (25%)
Tryp_SPc 252..482 CDD:214473 57/230 (25%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 60/240 (25%)
Tryp_SPc 66..287 CDD:238113 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.