DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss30

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:276 Identity:84/276 - (30%)
Similarity:132/276 - (47%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 ELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIF--HNGQYLAGGSLIQPNVVLTVAH--R 287
            ::|...||.|...| ::|.|   ..|...|:||.|:::  .:| ::.|||||....|||.||  |
Mouse    59 DILPSVCGHSRDAG-KIVGG---QDALEGQWPWQVSLWITEDG-HICGGSLIHEVWVLTAAHCFR 118

  Fly   288 VITIETELVVRAGDWDLKSDREIFLSEQRE----VERAVIHEGF---DFKSGANNLALLFLNSPF 345
            .....:...|:.|...|.      |.|...    |....:|..:   |..||  ::||:.|::|.
Mouse   119 RSLNPSFYHVKVGGLTLS------LLEPHSTLVAVRNIFVHPTYLWADASSG--DIALVQLDTPL 175

  Fly   346 KLNDHIRTICLP------TPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKF- 403
            : ......:|||      ||     |..|.|.|||..:..|.  ::||:::.:.:::...|||. 
Mouse   176 R-PSQFTPVCLPAAQTPLTP-----GTVCWVTGWGATQERDM--ASVLQELAVPLLDSEDCEKMY 232

  Fly   404 -LRSTRLGAKFELPKNIICAGGELG-RDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQE 466
             .:.:.|..:..:..:::|||...| :|:|.||.|..|.|||   ||. :.|.||.:||:||.:.
Mouse   233 HTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSI---NSS-WTQVGITSWGIGCARP 293

  Fly   467 GIPAIYTEVSKFTNWI 482
            ..|.:||.|..:.:||
Mouse   294 YRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 77/253 (30%)
Tryp_SPc 252..482 CDD:214473 75/249 (30%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 79/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.