DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Tpsg1

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:280 Identity:77/280 - (27%)
Similarity:131/280 - (46%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LLSPSCGMSNAN--GLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVIT 290
            |..|.||....:  |.::|.|   ..|:...:||..::.....::.||||:.|..|||.||    
  Rat    13 LAVPGCGQPQVSHAGSRIVGG---HAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAH---- 70

  Fly   291 IETELVVRAGDWDLKSDREIFLSEQ--------REVERAVIHEGFDFKSGAN-NLALLFLNSPFK 346
                  ..:|..: .||.|:.|.|.        ..|::.:::.......|:: ::||:.|.:|..
  Rat    71 ------CFSGSVN-SSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVA 128

  Fly   347 LNDHIRTICLPTPNKSF-AGRRCTVAGWG--------KMRYEDQRYSTVLKKVQLLVVNRNVCEK 402
            |:..::.:|||..:..| .|.:|.|.|||        |..|.       |::.::.||:...|.:
  Rat   129 LSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYN-------LQEAKVSVVDVETCSQ 186

  Fly   403 FLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEG 467
            ...|:. |:..:  .:::||.|.  .|.|..|.|..|.|.:    :|:::|||:|:||.|||:..
  Rat   187 AYSSSN-GSLIQ--SDMLCAWGP--GDACQDDSGGPLVCRV----AGIWQQAGVVSWGEGCGRPD 242

  Fly   468 IPAIYTEVSKFTNWITEKLL 487
            .|.:|..|:.:.|||...:|
  Rat   243 RPGVYARVTAYVNWIHRHIL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 69/252 (27%)
Tryp_SPc 252..482 CDD:214473 67/247 (27%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 69/257 (27%)
Tryp_SPc 30..260 CDD:238113 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.