DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss42

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:324 Identity:91/324 - (28%)
Similarity:143/324 - (44%) Gaps:51/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 VNNGGYPANNGGYPANNGGYPT-TNVGNPTNNGGNPTTNFGNPTNNGGNPTTNVGSSELLSPSCG 234
            ::..|:|:.....|..|...|| .:.....:.|.  ||.|         |.||      .|..||
  Rat    31 LSTSGFPSGLSESPGENSPPPTPVHTSKVASQGS--TTRF---------PFTN------FSIVCG 78

  Fly   235 ---MSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELV 296
               |....|:...||         ::||.|::.....::.||||:....|||.|| .|....:..
  Rat    79 QPLMKIMGGVDAEEG---------KWPWQVSLRVRHMHVCGGSLLNSQWVLTAAH-CIHSRVQYN 133

  Fly   297 VRAGDWDLKSDREIFLSEQR---EVERAVIHEGFDFKSGA-NNLALLFLNSPFKLNDHIRTICLP 357
            |:.|      ||.::.....   .::...:|..|...:.. |::|||.|..|......|..||:|
  Rat   134 VKMG------DRSVYRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVP 192

  Fly   358 TPNKSF---AGRRCTVAGWGKMRYEDQRYST-VLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKN 418
            |  .:|   ||.:|.|.||||......:..| :|::|...::....|.:.|:.....:...:.:.
  Rat   193 T--GTFHVKAGTKCWVTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRG 255

  Fly   419 IICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
            ::||..|.|:|.|.||.|..|.|..  :|..|  |.|:|:||:|||::|.|.:||:|:.:..|:
  Rat   256 MVCAYKEGGKDACQGDSGGPLSCEF--DNRWV--QIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089 4/17 (24%)
Tryp_SPc 250..485 CDD:238113 71/241 (29%)
Tryp_SPc 252..482 CDD:214473 70/237 (30%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 73/252 (29%)
Tryp_SPc 84..315 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.