DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:133/266 - (50%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LSPSCGMSNANGLQMVEGITI---DQARPAQYPWAVAI---FHNGQYLAGGSLIQPNVVLTVAHR 287
            |||...:.:|....:.:.:.|   .:|..:::||.|::   |....:..|||||.|..|||.||.
  Rat    10 LSPLASLVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHC 74

  Fly   288 V-ITIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHI 351
            | :.|::..:.|.   .|:.....:..:...|.|.|:|..:.......::|||.|.:|..::.||
  Rat    75 VGLHIKSPELFRV---QLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHI 136

  Fly   352 RTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYSTV-LKKVQLLVVNRNVCEKFLRSTRLGAKFE 414
            ....||..:::| :|..|.|.|||.:..::...... ||:|::.:|..::|::... |.|....:
  Rat   137 HPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYH-TGLYTGDD 200

  Fly   415 LP---KNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVS 476
            :|   ..::|||.... |:|.||.|..|.|.:    .|.:.|||:|:||.||.:...|.|||.|:
  Rat   201 VPIVQDGMLCAGNTRS-DSCQGDSGGPLVCKV----KGTWLQAGVVSWGEGCAEANRPGIYTRVT 260

  Fly   477 KFTNWI 482
            .:.:||
  Rat   261 YYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/242 (31%)
Tryp_SPc 252..482 CDD:214473 72/238 (30%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 75/246 (30%)
Tryp_SPc 30..266 CDD:214473 73/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.