DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss29

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:131/260 - (50%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 DQARPAQYPWAVAI------FHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDR 308
            :.|...::||.|::      :.:..::.|||:|.|..|||.||         .:...|.|..:.|
  Rat    35 NSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAH---------CIHESDADPSAFR 90

  Fly   309 ----EIFL---SEQREVERAVIHEGFDFKSG-ANNLALLFLNSPFKLNDHIRTICLPTPNKSFAG 365
                :::|   .:..:|.|.:||..| .:|| .:::|||.|....:...:::.:.|...:.....
  Rat    91 IYLGQVYLYGGEKLLKVSRVIIHPDF-VRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTK 154

  Fly   366 RR-CTVAGWGKM-RYEDQRYSTVLKKVQLLVVNRNVCEKFLR-STRL---GAKFELPKNIICAGG 424
            :. |.|.|||.: .:|.......|::||:.:|:..:|||..| :|||   |.:..| ::::|||.
  Rat   155 KDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLIL-QDMLCAGS 218

  Fly   425 ELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKLLPF 489
            . |||:|.||.|..|.|::    :|.:...|:|:||.||..:.||.:|..|..|..|||.::..|
  Rat   219 H-GRDSCYGDSGGPLVCNV----TGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQMQKF 278

  Fly   490  489
              Rat   279  278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/254 (30%)
Tryp_SPc 252..482 CDD:214473 73/249 (29%)
Prss29XP_017453326.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.