DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss30

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:283 Identity:80/283 - (28%)
Similarity:131/283 - (46%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQ-YLAGGSLIQPNVVLTVAH- 286
            |..::|....|       ::|.|   ..|...::||.|::....: ::.|||||....|||.|| 
  Rat    19 GRGDILHSGAG-------KIVGG---QDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHC 73

  Fly   287 --RVITIETELVVRAGDWDLKSDREIFLSEQRE----VERAVIHEGF---DFKSGANNLALLFLN 342
              |.:. .:...|:.|...|.      |:|...    |....::..:   |..||  ::|||.|:
  Rat    74 FCRPLN-SSFYHVKVGGLTLS------LTEPHSTLVAVRNIFVYPTYLWEDASSG--DIALLRLD 129

  Fly   343 SPFKLNDHIRTICLP------TPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCE 401
            :|.: ......:|||      ||     |..|.|.|||..  .::..::||:::.:.:::...||
  Rat   130 TPLQ-PSQFSPVCLPQAQAPLTP-----GTVCWVTGWGAT--HERELASVLQELAVPLLDSEDCE 186

  Fly   402 KF--LRSTRLGAKFELPKNIICAGGELG-RDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGC 463
            :.  :..|.|..|..:..:::|||...| :|:|.||.|..|.|:|   ||. :.|.||.:||:||
  Rat   187 RMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAI---NSS-WIQVGITSWGIGC 247

  Fly   464 GQEGIPAIYTEVSKFTNWITEKL 486
            .:...|.:||.|..:.:||...|
  Rat   248 ARPNKPGVYTRVPDYVDWIQRTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/254 (29%)
Tryp_SPc 252..482 CDD:214473 72/249 (29%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.