DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG33225

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:291 Identity:80/291 - (27%)
Similarity:135/291 - (46%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMS-NANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAH 286
            :|||.||:..||.: :.:.::.|.|.. |..|.|. ||.|.:.........||||....|||.|.
  Fly    35 LGSSTLLTNDCGTTRHPSRIRRVVGGN-DADRFAN-PWMVMVLGENNVFCSGSLITRLFVLTSAS 97

  Fly   287 RVITIETELVVRAGDW-------DLKSDREIFLSEQREVERAVIHEGFDFKSGAN-NLALLFLNS 343
            .::::..::::  |::       |..|.|::.     ::::.:||..|..::... ::|||.|..
  Fly    98 CLLSLPKQVIL--GEYDRNCTSADCTSIRQVI-----DIDQKIIHGQFGLETVKKYDIALLRLAK 155

  Fly   344 PFKLNDHIRTICLPTPNKSFAGR---RCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLR 405
            ...::|::|.|||....:  .||   ..|..|||...:.:.  ||:|:.|.|..:||..|:..||
  Fly   156 KVSISDYVRPICLSVDRQ--VGRSVQHFTATGWGTTEWNEP--STILQTVTLSKINRKYCKGRLR 216

  Fly   406 STRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQ------AGIVNWG-VGC 463
            .       .:..:.:|.||. .:|||:||.|..|..::..:..|.:..      .|||::| ..|
  Fly   217 Q-------NIDASQLCVGGP-RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSC 273

  Fly   464 GQEGIPAIYTEVSKFTNWI--------TEKL 486
            ...|   :||.|..:.:||        |||:
  Fly   274 SGIG---VYTNVEHYMDWIVRTINKSNTEKI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 69/260 (27%)
Tryp_SPc 252..482 CDD:214473 65/247 (26%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 68/256 (27%)
Tryp_SPc 57..292 CDD:238113 70/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.