DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG33226

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:119/276 - (43%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 ELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITI 291
            :||.|:|..:.....:.:.|  ...|....:||.|.|...|.:..|||||....|||.||  ...
  Fly    30 DLLDPNCVQTPVGVREQILG--GHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAH--CHS 90

  Fly   292 ETELVVRAGDWDLKSDREIFLSE-------QREVERAVIHEGF-DFKSGANNLALLFLNSPFKLN 348
            ...|.||.|.:...:.|.:..|:       :.:|:|..:|..: |:.:  .::||..|..|.:.|
  Fly    91 RYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHN--YDIALFLLAKPVRYN 153

  Fly   349 DHIRTIC-LPTPNKSFAGR------RCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRS 406
            ...|.|| |.|.||....:      ...|.||||.  |.|..||:|:...|..::|..|.:.   
  Fly   154 VQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKT--ESQLTSTILQTTSLFHLDRKFCAQI--- 213

  Fly   407 TRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQA--GIVNWGV-GCGQEGI 468
              ...|...|.  ||||.... .|||||.|..|...:  ..|||....  ||:::|. .|.:   
  Fly   214 --FDRKIGWPH--ICAGHSQS-STCTGDSGGPLSAEL--TFSGVKRTVLFGIISYGAPNCRE--- 268

  Fly   469 PAIYTEVSKFTNWITE 484
            ..::|.|.:::|||.:
  Fly   269 VTVFTNVLRYSNWIRD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/253 (30%)
Tryp_SPc 252..482 CDD:214473 74/247 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/259 (30%)
Tryp_SPc 47..282 CDD:214473 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.