DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and TPSG1

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:299 Identity:91/299 - (30%)
Similarity:139/299 - (46%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 NGGNPTTNFGNPTNNGGNPTTNVGSSELLSPSCG---MSNANGLQMVEGITIDQARPA-QYPWAV 261
            :||:.....|:|.   |.|:    |.:|   .||   :|:|.| ::|.|    .|.|| .:||..
Human    29 HGGSAVGFLGSPP---GTPS----SFDL---GCGRPQVSDAGG-RIVGG----HAAPAGAWPWQA 78

  Fly   262 AIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDREIFLSEQR--------EV 318
            ::.....::.||||:.|..|||.||          ..:|..: .||.::.|.|..        .|
Human    79 SLRLRRVHVCGGSLLSPQWVLTAAH----------CFSGSLN-SSDYQVHLGELEITLSPHFSTV 132

  Fly   319 ERAVIHEGFDFKSG-ANNLALLFLNSPFKLNDHIRTICLPTPNKSFA-GRRCTVAGWGKMRYED- 380
            .:.::|.....:.| :.::||:.|:.|..|:..|..:|||..:..|. |.||.|.|||..|..: 
Human   133 RQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEP 197

  Fly   381 --QRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSI 443
              ..||  |::|::.||:...|.:.....  |... |..:::||.|.  .|.|..|.|..|.|.:
Human   198 LPPPYS--LREVKVSVVDTETCRRDYPGP--GGSI-LQPDMLCARGP--GDACQDDSGGPLVCQV 255

  Fly   444 GGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
                :|.:.|||.|:||.|||:...|.:||.|..:.|||
Human   256 ----NGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/247 (31%)
Tryp_SPc 252..482 CDD:214473 74/243 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 76/253 (30%)
Tryp_SPc 63..293 CDD:238113 78/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.