DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG30289

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:274 Identity:74/274 - (27%)
Similarity:125/274 - (45%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SELLSPSCGMSNANGL--QMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRV 288
            |.||..:||:|..:..  .:..|.   :....:.||.|.::.:..  .|||||....|||.|| .
  Fly    23 SRLLVENCGISKDDPYVPNIFGGA---KTNIQENPWMVLVWSSKP--CGGSLIARQFVLTAAH-C 81

  Fly   289 ITIETELVVRAGDWDLKSDREIFLSE-------QREVERAVIHEGFDFKSGANNLALLFLNSPFK 346
            ::.| :|.||.||::........|:.       ...|:..::||.::..:..|::|||.::...:
  Fly    82 VSFE-DLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVE 145

  Fly   347 LNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCE-KFLRSTRLG 410
            .:|::|.|||....:..:....||.|||:..|  .::|.:|....|..::.:.|. ||.:     
  Fly   146 YSDYVRPICLLVGEQMQSIPMFTVTGWGETEY--GQFSRILLNATLYNMDISYCNIKFNK----- 203

  Fly   411 AKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEV 475
               :..::.||||.... :||.||.|..|.......|..:..|.|:|::|.......:..:||.|
  Fly   204 ---QADRSQICAGSHTS-NTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNV 264

  Fly   476 SKFTNWITEKLLPF 489
            |....||..|::.|
  Fly   265 SYHREWIFNKMVQF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 65/242 (27%)
Tryp_SPc 252..482 CDD:214473 63/237 (27%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 64/246 (26%)
Tryp_SPc 42..271 CDD:238113 64/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.