DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG30088

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:124/275 - (45%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SSELLSPSCGMSNANGL--QMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHR 287
            ::..|.||||:|..:.:  ::|.|   .:|.....|:...::::.:...||::|....:||.|| 
  Fly    25 AANFLIPSCGVSYESNVATRIVRG---KEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAH- 85

  Fly   288 VITIETELVVRAGDWDLKSDREIF------LSEQREVERAVIHEGFDFKSGANNLALLFLNSPFK 346
              .:...|.||.|:.|:..:.:..      .:|:.::..|..::.|| :..||::|||.|:...:
  Fly    86 --CMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIR 147

  Fly   347 LNDHIRTICL-----PTPN----KSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEK 402
            .|.||:.|||     ..||    ::|        |||:.  |....:.||:...|...:...|..
  Fly   148 FNVHIQPICLILNPAAAPNVHEFQAF--------GWGQT--ETNHSANVLQTTVLTRYDNRHCRS 202

  Fly   403 FLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEG 467
            .|       ...:..|.:|.|.: |.|||:||.|..|...:..:....|.|.|||::|....|. 
  Fly   203 VL-------SMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS- 258

  Fly   468 IPAIYTEVSKFTNWI 482
             |.:||.|..:..||
  Fly   259 -PGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 66/248 (27%)
Tryp_SPc 252..482 CDD:214473 64/244 (26%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/254 (26%)
Tryp_SPc 45..273 CDD:238113 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.