DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG30083

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:128/269 - (47%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIF-HNGQYLA----GGSLIQPNVVLTVA 285
            |:.|.|:||..:.:. :::.|   ..|.....||...|| :|.:.:|    ||:||....||:.|
  Fly    18 SQFLEPNCGYPDISP-KIMHG---QNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAA 78

  Fly   286 HRVITIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDH 350
            | .|..:..|.||.|:   .|....|     .|.:|..::.|...|.:|::.:|.:....|.|..
  Fly    79 H-CIKRDQILAVRLGE---HSSSRYF-----AVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAV 134

  Fly   351 IRTICL---PT--PN-KSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRL 409
            ||.||:   ||  || |:|     ..|||||.  |::.:|.|||.|:|..:|.:.|...|     
  Fly   135 IRPICIITDPTKVPNVKTF-----KAAGWGKT--ENETFSKVLKTVELNELNASECYNML----- 187

  Fly   410 GAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVG-CGQEGIPAIYT 473
              ...:.::.||||...| |||.||.|..|...:..:.|..|.|.||:::|.. |..   |.:||
  Fly   188 --WVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS---PGVYT 246

  Fly   474 EVSKFTNWI 482
            .:|.|.:||
  Fly   247 RLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 81/245 (33%)
Tryp_SPc 252..482 CDD:214473 79/241 (33%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 80/251 (32%)
Tryp_SPc 34..255 CDD:238113 80/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.