DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG30082

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:270 Identity:85/270 - (31%)
Similarity:125/270 - (46%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SELLSPSCG----MSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAH 286
            ::.:.|:||    :...|  ::|.|.|.|   ....||...:..|...:..|:||....|||.||
  Fly    21 AQFIDPNCGTTINLPPTN--RIVGGRTAD---IGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAH 80

  Fly   287 RVITIETELVVRAGDWDLK------SDREIFLSEQREVERAVIHEGFDFKSGA-NNLALLFLNSP 344
            .:.:... |.||.|::|..      |:..|...|:..||.|.||..|..:..: |::.||.||..
  Fly    81 CLHSFHL-LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGT 144

  Fly   345 FKLNDHIRTICL-PTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTR 408
            ......||.||| ..|.:.........|||||:...:.  :|||:.|.|:.::::.||:.||::.
  Fly   145 VVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINT--ATVLQTVNLIRLDQSDCERSLRTSL 207

  Fly   409 LGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWG-VGCGQEGIPAIY 472
            ...:|       || |:...|||:||.|..|...:.........|.|||::| ..|  .| |.:|
  Fly   208 SYGQF-------CA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RG-PGVY 261

  Fly   473 TEVSKFTNWI 482
            |.|..|||||
  Fly   262 TYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 78/242 (32%)
Tryp_SPc 252..482 CDD:214473 75/238 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 79/248 (32%)
Tryp_SPc 40..274 CDD:238113 81/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.