DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:251 Identity:78/251 - (31%)
Similarity:121/251 - (48%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QARPAQYPWAVAIFHNGQY---LAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDREIFL 312
            :|..:::||.|::.....|   ..|||||.|..|||.||.|           |. .:||. ::|.
Mouse    37 EASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCV-----------GP-HIKSP-QLFR 88

  Fly   313 SEQRE-----------VERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSF-AG 365
            .:.||           :.|.|:|..:....|..::|||.|..|..::.|:..|.||..:::| .|
Mouse    89 VQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPG 153

  Fly   366 RRCTVAGWGKMRYED---QRYSTVLKKVQLLVVNRNVCE-KFLRSTRLGAKFELPKNIICAGGEL 426
            ..|.|.|||.:..::   ..|.  ||:|::.:|..::|: |:......|..|.:..:.:...|..
Mouse   154 TSCWVTGWGDIDNDEPLPPPYP--LKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNT 216

  Fly   427 GRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
            .||:|.||.|..|.|.:    .|.:.|||:|:||.||.|...|.|||.|:.:.:||
Mouse   217 RRDSCQGDSGGPLVCKV----KGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 78/251 (31%)
Tryp_SPc 252..482 CDD:214473 76/248 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 78/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.