DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss29

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:289 Identity:82/289 - (28%)
Similarity:137/289 - (47%) Gaps:44/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMSNANGLQMVEGITIDQARP-AQYPWAVAI----------FHNGQYLAGGSLI 276
            :|.|...:|:.|   ..|:.|  ||....:.| .::||.|::          .||    .|||:|
Mouse    12 LGCSIAGTPAPG---PEGVLM--GIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHN----CGGSII 67

  Fly   277 QPNVVLTVAHRVITIETE---LVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLAL 338
            .|..|||.||.:...:.:   ..:|.|:..|...:|:.     .|.|.:||..|......:::||
Mouse    68 HPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELL-----SVSRVIIHPDFVHAGLGSDVAL 127

  Fly   339 LFLNSPFKLNDHIRTICLPTPNKSFAGRR-CTVAGWGKM---RYEDQRYSTVLKKVQLLVVNRNV 399
            |.|....:...:::.:.||:.:.....:. |.|.|||.:   |.....|.  |::||:.:::.::
Mouse   128 LQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYR--LQQVQVKIIDNSL 190

  Fly   400 CEKF----LRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWG 460
            ||:.    .|....|.|..| |:::|||.: |:|:|.||.|..|.|::    :|.:...|:|:||
Mouse   191 CEEMYHNATRHRNRGQKLIL-KDMLCAGNQ-GQDSCYGDSGGPLVCNV----TGSWTLVGVVSWG 249

  Fly   461 VGCGQEGIPAIYTEVSKFTNWITEKLLPF 489
            .||.....|.:|..|..|..|||:::..|
Mouse   250 YGCALRDFPGVYARVQSFLPWITQQMQRF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 73/256 (29%)
Tryp_SPc 252..482 CDD:214473 70/251 (28%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 74/259 (29%)
Tryp_SPc 31..271 CDD:214473 71/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.