DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss28

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:294 Identity:70/294 - (23%)
Similarity:136/294 - (46%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LLSPSCGMSNANGLQMVEGITIDQAR-----------PAQYPWAVAI------FHNGQYLAGGSL 275
            ||:.||..|..    .:..::|.:::           |.::||.|::      .::..::.|||:
Mouse     6 LLALSCLESTV----FMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSI 66

  Fly   276 IQPNVVLTVAHRVITIETELV---VRAGDWDLKSDREIFLSEQRE---VERAVIHEGFDFKSGAN 334
            |.|..:||.||.:.:.:.:..   |:.|        |::|.:::|   :.|.:||..::..|...
Mouse    67 IHPQWILTAAHCIQSQDADPAVYRVQVG--------EVYLYKEQELLNISRIIIHPDYNDVSKRF 123

  Fly   335 NLALLFLNSPFKLNDHIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQR------YSTVLKKVQL 392
            :|||:.|.:....:.::..:.||..:.:| :..:|.:.|||.:.   ||      |.  |.:|::
Mouse   124 DLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLL---QRVPLQPPYQ--LHEVKI 183

  Fly   393 LVVNRNVCEKFLRST-----RLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYE 452
            .:.:...|::..|..     :..|.|:   :::|||.. ||..|.||.|..|.|    ..|..:.
Mouse   184 PIQDNKSCKRAYRKKSSDEHKAVAIFD---DMLCAGTS-GRGPCFGDSGGPLVC----WKSNKWI 240

  Fly   453 QAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486
            |.|:|:.|:.| ...:|:|::.|.....||.:.:
Mouse   241 QVGVVSKGIDC-SNNLPSIFSRVQSSLAWIHQHI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 64/269 (24%)
Tryp_SPc 252..482 CDD:214473 62/264 (23%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 64/262 (24%)
Tryp_SPc 31..269 CDD:214473 62/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.