DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and PRSS21

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:288 Identity:82/288 - (28%)
Similarity:131/288 - (45%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIET 293
            ||..||...... ::|.|   :.|...::||..::.....::.|.||:.....||.||   ..||
Human    29 LSGPCGRRVITS-RIVGG---EDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAH---CFET 86

  Fly   294 ---------------ELVVRAGDWDLKS------DREIFLSEQREVERAVIHEGFDFKSGANNLA 337
                           :|......|.|::      ...|:||     .|.:.:..:|       :|
Human    87 YSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLS-----PRYLGNSPYD-------IA 139

  Fly   338 LLFLNSPFKLNDHIRTICLPTPNKSFAGRR-CTVAGWGKMRYEDQRYST--VLKKVQLLVVNRNV 399
            |:.|::|.....||:.|||......|..|. |.|.|||.:: ||:...:  .|::||:.::|.::
Human   140 LVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIK-EDEALPSPHTLQEVQVAIINNSM 203

  Fly   400 CEKFLRSTRLGAKFELPKNI----ICAG-GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNW 459
            |      ..|..|:...|:|    :||| .:.|:|.|.||.|..|.|:    .:|::.|.|:|:|
Human   204 C------NHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACN----KNGLWYQIGVVSW 258

  Fly   460 GVGCGQEGIPAIYTEVSKFTNWITEKLL 487
            |||||:...|.:||.:|....|| :||:
Human   259 GVGCGRPNRPGVYTNISHHFEWI-QKLM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/263 (28%)
Tryp_SPc 252..482 CDD:214473 72/258 (28%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 76/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6434
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.