DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:481 Identity:114/481 - (23%)
Similarity:183/481 - (38%) Gaps:107/481 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TVLIEPNGPEDDKVGVNGINAQLSPTRELTRDRPNTIESQVKEIN--DFSGRPTNNERNPA-TEP 122
            |:.:..||                   :||.|:|      :.:.|  :|....|.:...|. |:.
Zfish   107 TIFVNNNG-------------------DLTFDKP------LHQYNPDNFPAYSTRDIIAPLWTDI 146

  Fly   123 NNG-----GYTTPNGGYPVNNGGYPVNNGGYPSNN----------------GGYPSNNGGYPV-- 164
            |||     .|.....|..:|.....:|. .:|:.|                .||..:...:.|  
Zfish   147 NNGMEGTISYRQVTNGDILNRASKDINR-YFPNLNFSASWVFIATWDKVPYYGYRESESTFQVVL 210

  Fly   165 ---NNGGYPVNNGGY----PANNGGYPANNG----GYPTTNVGN-----PTNNGGNPTTNFGNPT 213
               ....:.:.:..|    .:...||..|..    ..|.::|.|     ..|..|.......|.:
Zfish   211 VSDKKRSFTLMHYDYITYTQSAESGYDTNGSTVFYSIPVSDVTNLPYTSNVNVKGRWVFRVDNSS 275

  Fly   214 NNGGNPTTNVGSSELLSPS---CG---MSNANGLQMVEGITIDQARPAQYPWAVAIF-HNGQYLA 271
            ...|: ..|..|..|.|||   ||   ::::||  .|.|   ..:....:||..::: ::|| ..
Zfish   276 EVKGS-CINTNSQALDSPSAAVCGIIPVNSSNG--TVGG---QNSSAVHWPWQASLYWYSGQ-TC 333

  Fly   272 GGSLIQPNVVLTVAHRVITIETE-----LVVRAGDWDLKSDREIFLSE-QREVERAVIHEGFDFK 330
            |||||....||:.||   ....:     |.|..|.   |:..:...|. .|.|:..:.|..::..
Zfish   334 GGSLINKEWVLSAAH---CFNGQRNGFYLTVILGP---KTQNKYDPSRISRSVKAVIKHPYYNPN 392

  Fly   331 SGANNLALLFLNSPFKLNDHIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYS-TVLKKVQLL 393
            :..|::||:.|:.|....|.||.:||......| :.....:..|..:.......| .:.::|::.
Zfish   393 TNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVP 457

  Fly   394 VVNRNVCEKFLRSTRLGAKFELPKNIICAG-GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIV 457
            |:....|      ..|.....:..|:|||| .:.|:|.|.||.|..:.    ...|.|:.|:|||
Zfish   458 VIGNRQC------NCLYGVGSITDNMICAGLLKEGKDLCQGDSGGPMV----SNQSSVWVQSGIV 512

  Fly   458 NWGVGCGQEGIPAIYTEVSKFTNWIT 483
            ::|.||.|...|.:||.||::..|||
Zfish   513 SFGSGCAQSEFPGVYTRVSRYQEWIT 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089 11/81 (14%)
Tryp_SPc 250..485 CDD:238113 67/244 (27%)
Tryp_SPc 252..482 CDD:214473 64/239 (27%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 23/131 (18%)
Tryp_SPc 309..537 CDD:238113 66/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.