DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:165423

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:270 Identity:72/270 - (26%)
Similarity:131/270 - (48%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVIT--IET 293
            |:||.:..| .::|.|   ..|....:||..::..:|.:..|||||....:|:.||...:  ..:
Zfish    27 PACGKAPLN-TKIVGG---TNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPS 87

  Fly   294 ELVVRAG--DWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICL 356
            :..|..|  ..||.:..|:    .:.|.:.::|..:...:..|::|||.|:||...:::|:.:||
Zfish    88 DYTVYLGRQSQDLPNPNEV----SKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCL 148

  Fly   357 PTPNKSFAGRRCTVAGWGKMRYEDQRYS-TVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNII 420
            .....:|......:.|||.:.......| .:|::|.:.:|..|:|     :...|....:..|::
Zfish   149 AADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLC-----NCLYGGGSSITNNMM 208

  Fly   421 CAG-GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITE 484
            ||| .:.|:|:|.||.|..:..    ::...:.|||:|::|.||.....|.:|..||::.|||::
Zfish   209 CAGLMQGGKDSCQGDSGGPMVI----KSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

  Fly   485 ----KLLPFD 490
                ..:|.|
Zfish   270 YVRASFIPVD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 64/244 (26%)
Tryp_SPc 252..482 CDD:214473 62/235 (26%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 64/245 (26%)
Tryp_SPc 38..269 CDD:238113 66/246 (27%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.