DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:163079

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:280 Identity:81/280 - (28%)
Similarity:126/280 - (45%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNG--QYLAGGSLIQPNVVLTVA 285
            :|.|::    ||.:..| .:::.|:...|   ..:||..:|....  ::..|||||....|||.|
Zfish    21 LGQSDV----CGRAPLN-TKIIGGLNATQ---GSWPWQASINLKATEEFYCGGSLINKGWVLTTA 77

  Fly   286 HRVITI--ETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLN 348
             :|..:  .:::||..|...........:|  |.|.:.:.|.  ::.|..:|||||.|:||...:
Zfish    78 -KVFALMPASDIVVYLGRQTQNGSNPYEIS--RTVTKIIKHP--NYNSLDSNLALLKLSSPVTFS 137

  Fly   349 DHIRTICLPTPNKSFA-GRRCTVAGWGKMR----YEDQRYSTVLKKVQLLVVNRNVCEKFLRSTR 408
            |:|:.:||......|. |....|.|||.:.    .|:.....||::|:..:||...|....... 
Zfish   138 DYIKPVCLAAAGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGI- 201

  Fly   409 LGAKFELPKNIICAG--GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAI 471
                  :...::|||  .|.|:..|.||.|..|....|    .::.|:|:|..|. ||..|.|.|
Zfish   202 ------ITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQG----AIWIQSGVVVSGY-CGLPGYPTI 255

  Fly   472 YTEVSKFTNWI---TEKLLP 488
            |..||::.:||   |...||
Zfish   256 YVRVSEYEDWISYYTNSSLP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 73/248 (29%)
Tryp_SPc 252..482 CDD:214473 69/240 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 71/250 (28%)
Tryp_SPc 36..267 CDD:238113 72/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.