DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and LOC100004427

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:286 Identity:87/286 - (30%)
Similarity:118/286 - (41%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMSNAN-----GLQMVEGITIDQARPAQYPWAVAI-FHN-GQYLAGGSLIQPNV 280
            :|.|::    ||.:..|     ||...||         .:||..:| |.: ||:...||||....
Zfish    21 LGQSDV----CGRAPLNTKIVGGLNATEG---------SWPWQASINFKSTGQFFCSGSLISERW 72

  Fly   281 VLTVAHRVITIETELVVRAGDWDLKSDREIFL-------SEQREVERAVIHEGFDFKSGANNLAL 338
            |||.|.....|..            ||..|:|       |...|:.|.||.     .|...::||
Zfish    73 VLTAASCFQRINV------------SDVVIYLGRLTTNGSNPYEIPRTVIQ-----VSVTEDIAL 120

  Fly   339 LFLNSPFKLNDHIRTICLPTPNKSFA-GRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEK 402
            :.|:|.....|:||.:||......|. |....|.|||.....:...|.:||:|:..:||...|..
Zfish   121 VQLSSSVTFTDYIRPVCLAAAGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSN 185

  Fly   403 FLRSTRLGAKFELPKNIICAG--GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQ 465
            ....|.|       .|:||||  .|.|:..|..|.||.|....|.:    :.|:|:|.: ..|||
Zfish   186 INGITNL-------DNVICAGFVNETGKAPCWEDFGSPLVTRQGSQ----WIQSGVVVF-TFCGQ 238

  Fly   466 EGIPAIYTEVSKFTNWI---TEKLLP 488
            .|.|.:|..||::..||   |...||
Zfish   239 NGFPTLYARVSEYEEWIRNYTSSSLP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/249 (31%)
Tryp_SPc 252..482 CDD:214473 73/241 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 77/257 (30%)
Tryp_SPc 36..257 CDD:238113 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.