DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:277 Identity:90/277 - (32%)
Similarity:142/277 - (51%) Gaps:33/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAI--FHNGQYLAGGSLIQPNVVLTVAH 286
            |.|..|:..||.... |.::|.|:   :|.|..:||.|.|  ..|| ::.|||:|..|.||:.||
Zfish    14 GLSTCLAQVCGRPPL-GKRIVGGV---EASPGSWPWQVDIQMGSNG-HVCGGSIIAKNWVLSAAH 73

  Fly   287 RVITIETELVVRAGDWDLKSDREIF-----LSEQREVERAVIHEGFDFKSGANNLALLFLNSPFK 346
               .......|.|  :.|...|.:.     ..:...|:|.||.||:....|..::||:.|.:|..
Zfish    74 ---CFPNPSEVSA--YTLYMGRHLLNGYNQFEKVSYVQRVVIPEGYTDPQGGRDVALVQLRAPVS 133

  Fly   347 LNDHIRTICLPTPNKSF-AGRRCTVAGWG-KMRYEDQRYSTVLKKVQLLVVNRNVCE---KFLRS 406
            ..|.|:.:|||..:..| :|..|.|.||| |........:..|::|::.:::::.|:   :.|.|
Zfish   134 WTDRIQPVCLPFADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSS 198

  Fly   407 TRLGAKFELPKNIICAG-GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPA 470
            .  .:..::..::|||| .|.|:|:|.||.|..|.|.:|   :|.:.|||:|::|:||.|:..|.
Zfish   199 D--SSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVG---NGTWIQAGVVSFGLGCAQKNRPG 258

  Fly   471 IYTEVSKFTNWITEKLL 487
            ||:.||.|     |||:
Zfish   259 IYSRVSSF-----EKLI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 79/247 (32%)
Tryp_SPc 252..482 CDD:214473 79/242 (33%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 84/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.