DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5050 and CG5043

DIOPT Version :9

Sequence 1:NP_001246056.1 Gene:CG5050 / 35048 FlyBaseID:FBgn0032637 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_609838.1 Gene:CG5043 / 35046 FlyBaseID:FBgn0032636 Length:499 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:136/292 - (46%) Gaps:39/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QRKSVTSMKLFTMVVLHSWRQRRKEVRELKEMVQHLQDSSMKTKNELHVCGTLMRVEEKRNRELQ 97
            |...|.|:::|..::||:||:||:|||:|.:.|:..:.|.:|.:|:|||..:|..||::||..|.
  Fly   198 QDARVASLRIFNTIMLHAWRRRREEVRQLTDQVEDYKKSLVKNRNQLHVYNSLFSVEKRRNETLN 262

  Fly    98 IKLKLSTMSIDQVRSSCESLVNSVRDLTTEKRRLETDLEQRLQEYNELEEVSDKTKRLLFSAYVE 162
            .:|:.|.....|.:.|.|.|...:..:..||.:|..::..:.::...|:|:..:.|..||..:.:
  Fly   263 DQLRQSYRENAQTKLSYEELNAVLVQIRNEKEKLAEEVATKDRDIENLQEMQQQLKSELFQVHGQ 327

  Fly   163 QSSLQKQLAEEQRTTQRLQAEKDQLIQEVILAE----GRDNKYRQVREWYQRVLHKKEVCIYNLG 223
            |....::|...||..|..|..:|:|::::.|..    .:.:...|:|:...:|...|...     
  Fly   328 QGQQLEELTRLQREYQESQTAQDELLRQLNLLRIELALKSDFVDQLRDSLAKVQDLKRGS----- 387

  Fly   224 RRLHMLEEQLFDINEHTGELEQ-LRESAQQMSNEITELRQEINRNRNGVFGDSCCRLGLGRLHDH 287
                  :||...:.|.|.:||| :.|..:|:                 |...:|....||:....
  Fly   388 ------DEQFSKLLEQTLKLEQAIAEKEEQL-----------------VTLQNCLAATLGQRIRQ 429

  Fly   288 VIAPFQGNHIWIKLRRYSFNVIYLFALYLLPG 319
            ..|..|.      .:..::.:::..|.|:|||
  Fly   430 CFAQSQA------YQHATYRMLHFVAHYMLPG 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5050NP_001246056.1 ATP-synt_B 96..>197 CDD:304375 24/104 (23%)
CG5043NP_609838.1 Smc <213..>420 CDD:224117 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5H6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016736
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.