DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dl and RELB

DIOPT Version :9

Sequence 1:NP_001286014.1 Gene:dl / 35047 FlyBaseID:FBgn0260632 Length:999 Species:Drosophila melanogaster
Sequence 2:NP_006500.2 Gene:RELB / 5971 HGNCID:9956 Length:579 Species:Homo sapiens


Alignment Length:373 Identity:151/373 - (40%)
Similarity:209/373 - (56%) Gaps:64/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 APGQGPAVDGQQSLNYNGLPAQQQQQLAQSTKNVRKKPYVKITEQPAGKALRFRYECEGRSAGSI 74
            |||.||                              :|::.|||||..:.:||||||||||||||
Human   118 APGPGP------------------------------QPHLVITEQPKQRGMRFRYECEGRSAGSI 152

  Fly    75 PGVNSTPENKTYPTIEIVGYKG-RAVVVVSC-VTKDTPYRPHPHNLVGKEGCKKGVCTLEINSE- 136
            .|.:||..:||.|.||:....| |.|.|.:| |.||.|:|.|||:||||: |..|:|.:.:... 
Human   153 LGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKD-CTDGICRVRLRPHV 216

  Fly   137 TMRAVFSNLGIQCVKKKDIEAALKAREEIRVDPFKTGFSHRFQPSSIDLNSVRLCFQVFMESEQK 201
            :.|..|:|||||||:||:||||::.:.::.:||:..|.....|  .:|:|.||:|||.... :|:
Human   217 SPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQ--EVDMNVVRICFQASYR-DQQ 278

  Fly   202 GRFTSPLPPVVSEPIFDKKA--MSDLVICRLCSCSATVFGNTQIILLCEKVAKEDISVRFFEEKN 264
            |:... :.||:|||::|||:  .|:|.|||:...|....|..::.|||:||.||||||.|     
Human   279 GQMRR-MDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVF----- 337

  Fly   265 GQSVWEAFGDFQHTDVHKQTAITFKTPRYHTLDITEPAKVFIQLRRPSDGVTSEALPFEYVPMDS 329
            .::.||...||...|||:|.||.||||.|..|:|.||..|.:.|:|.:|||.||.|||.|:|.| 
Human   338 SRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRD- 401

  Fly   330 GKHTFWNLHRHLKR-KPDEDLFQQIL---------RLDAKREVQPPTI 367
              |..:.:.:..|| .||      :|         .:::||..:.|.|
Human   402 --HDSYGVDKKRKRGMPD------VLGELNSSDPHGIESKRRKKKPAI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlNP_001286014.1 RHD-n_Dorsal_Dif 47..220 CDD:143647 82/175 (47%)
IPT_NFkappaB 225..326 CDD:238582 49/100 (49%)
RELBNP_006500.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
RelB_leu_zip 18..96 CDD:318422
Leucine-zipper 40..68
RHD-n_RelB 125..296 CDD:143646 82/175 (47%)
RHD_dimer 304..400 CDD:318421 48/100 (48%)
RelB_transactiv 403..579 CDD:292799 9/45 (20%)
Nuclear localization signal. /evidence=ECO:0000255 433..438 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8582
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4542
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.