DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dl and Relb

DIOPT Version :9

Sequence 1:NP_001286014.1 Gene:dl / 35047 FlyBaseID:FBgn0260632 Length:999 Species:Drosophila melanogaster
Sequence 2:NP_033072.2 Gene:Relb / 19698 MGIID:103289 Length:558 Species:Mus musculus


Alignment Length:307 Identity:142/307 - (46%)
Similarity:193/307 - (62%) Gaps:19/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KPYVKITEQPAGKALRFRYECEGRSAGSIPGVNSTPENKTYPTIEIVGYKG-RAVVVVSC-VTKD 108
            :||:.|||||..:.:||||||||||||||.|.:||..:||.|.||:....| |.|.|.:| |.||
Mouse   102 RPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKD 166

  Fly   109 TPYRPHPHNLVGKEGCKKGVCTLEINSE-TMRAVFSNLGIQCVKKKDIEAALKAREEIRVDPFKT 172
            .|:|.|||:||||: |..|||.:.:... :.|..|:|||||||:||:||||::.:.::.:||:..
Mouse   167 WPHRVHPHSLVGKD-CTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA 230

  Fly   173 GFSHRFQPSSIDLNSVRLCFQVFMESEQKGRFTSPLPPVVSEPIFDKKA--MSDLVICRLCSCSA 235
            |.....|  .:|:|.||:|||.... :|:|.. ..:.|::|||::|||:  .|:|.|||:...|.
Mouse   231 GSLKNHQ--EVDMNVVRICFQASYR-DQQGHL-HRMDPILSEPVYDKKSTNTSELRICRINKESG 291

  Fly   236 TVFGNTQIILLCEKVAKEDISVRFFEEKNGQSVWEAFGDFQHTDVHKQTAITFKTPRYHTLDITE 300
            ...|..::.|||:||.||||||.|     ..:.||...||...|||:|.||.||||.|..|:|:|
Mouse   292 PCTGGEELYLLCDKVQKEDISVVF-----STASWEGRADFSQADVHRQIAIVFKTPPYEDLEISE 351

  Fly   301 PAKVFIQLRRPSDGVTSEALPFEYVPMDSGKHTFWNLHRHLKR-KPD 346
            |..|.:.|:|.:|||.||.|||.|:|.|   |..:.:.:..|| .||
Mouse   352 PVTVNVFLQRLTDGVCSEPLPFTYLPRD---HDSYGVDKKRKRGLPD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlNP_001286014.1 RHD-n_Dorsal_Dif 47..220 CDD:143647 83/175 (47%)
IPT_NFkappaB 225..326 CDD:238582 49/100 (49%)
RelbNP_033072.2 RelB_leu_zip 1..75 CDD:292798
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Leucine-zipper 22..50
RHD-n_RelB 103..274 CDD:143646 83/175 (47%)
RHD_dimer 282..378 CDD:292797 48/100 (48%)
RelB_transactiv 381..558 CDD:292799 4/15 (27%)
Nuclear localization signal. /evidence=ECO:0000255 387..391 0/3 (0%)
Nuclear localization signal. /evidence=ECO:0000255 411..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8810
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4542
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.940

Return to query results.
Submit another query.